Home|About BioLogo|Ordering|Contact|Help|News|GTC|Sitemap |Deutsch
   register
line
logo

Antibodies – Recombinant Proteins – Staining Reagents


for Biology and Medicine – Consultancy – Development – Production - Distribution
line
Search:
line
Products:
line
AGE
line
BioPrime Antibodies
line
BioPrime Staining Reagents
line
BioPrime Accessories
line
ECM
line
ELISA
line
Enzymes
line
Research
line
Proteins and Peptides
line
VECTOR Reagents
line
  Print data sheet   warenkorb_large (1K) add to basket

Products> Proteins and Peptides

Code N°


CHM-238: Eotaxin-2 Human Recombinant (CCL24); Eotaxin 2 Human




Price: 190 € / 20µg

Chemokines

Amino acid sequence:VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
 
Origin:Escherichia Coli
 
Format:The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
 
Quantity:20µg
 
Reconstitution:It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
 
Presentation:Sterile filtered white lyophilized (freeze-dried) powder.
 
Special properties:CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.
 
Storage:-20°C
 
Biological Activity: The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
 
Purity: Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
 
Synonyms: C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
 
Stability: Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
 
UniProt: O00175
 



Notes:
BIOLOGO reagents are intended for in vitro research only, not for clinical diagnostics or therapy. They must not be applied to living animals or humans.

For additional quantities please enquire.

 Print page


» Product list

BioLogo | Steindamm 1 G-H | 24119 Kronshagen | Germany | Phone +49 (0)431.5842 801 | Fax +49 (0)431.5842 803 | info@biologo.de