Research - DOG001: DOG1 (Discovered on GIST 1)

Products:

AGE

BioPrime Antibodies

BioPrime Staining Reagents

Proteins and Peptides

VECTOR Reagents

Products> Research

DOG001: DOG1 (Discovered on GIST 1)

Print page

place in shopping cart

Price: 310 € / 1 ml

Monoclonal antibody

Origin:	Mouse

Isotype:	IgG

Clone:	DOG1.1

Format:	liquid conc.

Quantity:	1 ml

Concentration:	50 µg/ml

Working concentration:	1-2 µg/ml

GIST Paraffin sections stained with DOG1.1, anti mouse IgG-HRP-Polymer and DAB

Presentation:	Antibody solution in stabilizing phosphate buffer pH 7.3. Contains 0.09 % sodium azide**. Use appropriate antibody diluent e.g. BIOLOGO Art . No. PU002.

Immunogen:	Synthetic peptide (FLJ34272) human DOG1 sequence: MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL .

Specificity:	Human DOG1, gastrointestinal stromal tumours (GIST)

Species Specificity:	Human, chicken, hamster, rat

General Information:	DOG1 (Discovered on GIST 1) Gen encodes a cell surface protein of unknown function, which is exprimed especially in gastrointestinal stromal tumours (GIST). The expression in GIST is independent of the expression of c-kit and PDGFR-alpha mutations. For this reason DOG1 antibody can detect a higher percentage of GIST (87%) than traditionally used markers like CD117 (c-kit)(74%) and CD34, which are used for the differential diagnoses of gastrointestinal stromal tumours (Espinosa et al., 2008). DOG1 immunoreactivity was 79% in GIST with PDGFRa mutations, while only 9% of these were CD117-positive. Therefore the diagnosis with DOG1 could also influence the therapy with Imatinib (Glivec®) a tyrosinkinase inhibitor, which is used for the treatment of CML and GIST.

Special properties:	The antibody is well suited for the detection of GIST in tissue sections (stomach, intestine, and different metastases). Usually the antigen is detected on the cell membrane, but in certain situations also cytoplasmatic staining was observed (e.g. in spindle cell GISTs).

Positive control:	GIST

Pre-treatment:	Heat pre-treatment of formalin-fixed tissue with Unmasking Fluid C or G (Art. No. DE000 and DE007)

Applications:	IHC (C,P)

Secondary reagents:	Heat pre-treatment of formalin-fixed tissue with Unmasking Fluid C or G (Art. No. DE000 and DE007)

Storage:	2-8°C

Expression: The expression of DOG1 can occur on the membrane and in cytoplasm.

References:
1. West R.B., et al. (2004) The novel marker , DOG1, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFRA mutation. Am J. Pathol. 165(1) 107-113.

2. Espinosa I., et al.(2008) A novel monoclonal antibody against DOG1 is a sensitive and specific marker for gastrointestinal stromal tumors. Am J. Surg. Pathol 32(2)210-218

3. Liegl B., et al. (2009) Monoclonal antibody DOG1.1 shows higher sensitivity than KIT in the diagnosis of gastrointestinal stromal tumors, including unusual subtypes. Am. J. Surg. Pathol 33(3) 437-446.

Notes:
** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!

*BIOLOGO's antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals.