Research - CDX002-G: CDX2, 1C7

Products:

AGE

BioPrime Antibodies

BioPrime Staining Reagents

Proteins and Peptides

VECTOR Reagents

Products> Research

CDX002-G: CDX2, 1C7

Print page

place in shopping cart

Price: 190 € / 5 ml

Monoclonal Antibodies

Origin:	Mouse

Isotype:	IgG mix kappa

Clone:	1C7

Format:	ready to use

Quantity:	5 ml

Concentration:	3 µg/ml

Working concentration:	neat

Presentation:	Purified IgG in PBS, pH 7.2, 0,09% sodium azide

Immunogen:	Recombinant human CDX2 AS 1-314 with GST-Tag. MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKE

Specificity:	CDX2, human

Species Specificity:	Human, others not tested

General Information:	CDX2 is a homeobox-gen encoding for an intestinal transcription factor, which is exprimed by nuclei of intestinal epithelial cells especially in the rectum and duodenum. It is over-expressed in colorectal carcinoma and related metastases. It was also identified in metaplasia of the stomach and in carcinoma of the gut. CDX2 is not produced by normal mucous membranes of the stomach.

Special properties:	The antibody against CDX2 is well suited for the detection of the product in cell nuclei and in tissue extracts.

Positive control:	Colon carcinoma

Pre-treatment:	Formalin-fixed tissue requires antigen unmasking in citrate buffer pH 6 (Art. No. DE000) 15-30 min at 100°C. Blocking of endogenous oxido-reductases with H2O2 1% 30 min., blocking of non-specific protein binding with SeaBlock (Art. No. PU083). Endogenous Biotin may be blocked with help of the VECTOR Avidin/Biotin Blocking Kit Ref. SP-2001) to avoid non-specific background staining.

Applications:	IHC (C,P)

Incubation time:	60 min at RT

Secondary reagents:	We recommend the use of BIOLOGO's Universal Staining System DAB (Art. No. DA005) or AEC (Art.-No. AE005), if higher sensitivity is required VECTASTAIN Elite ABC (Art. No. PK-6102) or ABC AP (Art. No. AK-5002) systems are applicable.

Storage:	2-8°C

References:
1. Barbareschi M., Murer B., Colby T.V., Chilosi M., Macri E., Loda M., Coglioni C. (2003) CDX-2 homeobox gene expression is a reliable marker of colorectal adenocarcinoma metastases to the lungs. Am J. Surg. Pathol. 27; 141-149

2. Werling R.W. Yaziji H., Bacchi C.E., Gown A.M. (2003) CDX2, a highly sensitive and specific marker of adenocarcinomas of intestinal origin: An immunohistochemical survey of 476 primary and metastatic carcinomas. Am. J. Surg. Pathol. 27; 303-310.

Notes:
*BIOLOGO's antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals.

** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!